DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and OCEL1

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_078854.1 Gene:OCEL1 / 79629 HGNCID:26221 Length:264 Species:Homo sapiens


Alignment Length:321 Identity:66/321 - (20%)
Similarity:104/321 - (32%) Gaps:94/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   639 NSTGSNS-SSSSGYETQQDRQRSTTPMSSNRSSASSSTTPPKLAASFVPAATSGSA----SGTSK 698
            |..||.| ::..|.|.|...|.:..|             ||..|....|..|..||    |..|:
Human     3 NPDGSASPTADPGSELQTLGQAARRP-------------PPPRAGHDAPRRTRPSARKPLSCFSR 54

  Fly   699 QRMPPQQSDYNSYNSNNAQHVASNSKKRMGSVGPSGGSNGQRQRSASGSNSGYQQVPP---PSSN 760
            :.||.::.                .|.|        ||.|.......|.....|.:.|   .:|.
Human    55 RPMPTREP----------------PKTR--------GSRGHLHTHPPGPGPPLQGLAPRGLKTSA 95

  Fly   761 SRSSIQ-QQNQHQ---KQQVQQKQAPSQQQQQQQQ------QYHQQAKHPSPSQQLAAAAHAYAH 815
            .|...| |...|:   |:.|.:.:..||.....::      :.|:...||.|..:|         
Human    96 PRPPCQPQPGPHKAKTKKIVFEDELLSQALLGAKKPIGAIPKGHKPRPHPVPDYEL--------- 151

  Fly   816 ATADTDSSATPRYDFSQYVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERL--- 877
                            :|.|:.:...|.||...|:..|.|:.:|...|...:.:.:.|...|   
Human   152 ----------------KYPPVSSERERSRYVAVFQDQYGEFLELQHEVGCAQAKLRQLEALLSSL 200

  Fly   878 ---ESARRCDNGYGDYDHIKRQIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVMDYD 935
               :|.:..        .:..::..|:|....|....:.:.|..||..||.|:|..:..:|
Human   201 PPPQSQKEA--------QVAARVWREFEMKRMDPGFLDKQARCHYLKGKLRHLKTQIQKFD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 21/104 (20%)
OCEL1NP_078854.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 33/145 (23%)
Occludin_ELL 156..253 CDD:284669 21/104 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4796
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.