DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and Ocel1

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_084141.2 Gene:Ocel1 / 77090 MGIID:1924340 Length:219 Species:Mus musculus


Alignment Length:238 Identity:51/238 - (21%)
Similarity:87/238 - (36%) Gaps:55/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   718 HVASNSKK-RMGSV----GPSGGSNGQ-----RQRSASGSNSGYQQVPPPSSNSRSSIQQQNQHQ 772
            |....|:: |.|.:    ||....|.:     |||:|:      .::|.|........|.|....
Mouse     4 HAGPASRRGRRGPLARLSGPEATCNSRPAARGRQRAAA------PRMPAPERPRSRRPQSQPGPG 62

  Fly   773 KQQVQQKQAPSQQQQQQQQQYHQQAKHPSPSQQLAAAAHAYAHATADTDSSATPRYDFS-QYVPI 836
            :..|:.::.....:.:.::..|.: |||                 .|......|..|:. :|.|:
Mouse    63 ELCVRPRKIVFADELRPREPLHPE-KHP-----------------RDLGPRLNPVPDYELKYPPV 109

  Fly   837 QTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERL---------ESARRCDNGYGDYDH 892
            .....|.||...|:..|.|:.:|...|...:.:.|.|...|         :.||..       .|
Mouse   110 TNRRDRSRYAAVFQDQYGEFSELQREVGATQAKLQQLEALLLSLPPPRSQKEARMA-------AH 167

  Fly   893 IKRQIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVMDYD 935
            ::|    |:|:...|....:.:.|.:||..||.|:|..:..:|
Mouse   168 VRR----EFEKKRGDPGFLDKQARCNYLKGKLRHLKAQIRKFD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 25/107 (23%)
Ocel1NP_084141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..110 25/129 (19%)
Occludin_ELL 109..206 CDD:284669 25/107 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4796
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.