DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and marveld2b

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_001119878.1 Gene:marveld2b / 563122 ZFINID:ZDB-GENE-050208-54 Length:572 Species:Danio rerio


Alignment Length:108 Identity:38/108 - (35%)
Similarity:60/108 - (55%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   831 SQYVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERLESARRCDNGYGDYDHIKR 895
            ::|..|:|.|.|.|||..|...|.||::|...|:.:..:|:::...:.:..:..:...:.:.|. 
Zfish   459 AKYPTIRTDEERERYKAVFNDQYAEYKELHAEVQVLTQKFEEMDNLMRNLPQRPSSQMEQERIS- 522

  Fly   896 QIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVMDYDKTL 938
            .||.||.|...|.|..|.:||.:||..|||||||.:.:|||.:
Zfish   523 SIVQEYNRKKADPTYQEKRERCEYLKNKLAHIKQKIQEYDKIM 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 34/98 (35%)
marveld2bNP_001119878.1 MARVEL 194..371 CDD:307448
Occludin_ELL 461..563 CDD:311321 36/102 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4796
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170004at33208
OrthoFinder 1 1.000 - - FOG0002166
OrthoInspector 1 1.000 - - otm24840
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.