DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and marveld2a

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:XP_005155591.1 Gene:marveld2a / 558720 ZFINID:ZDB-GENE-050411-59 Length:545 Species:Danio rerio


Alignment Length:153 Identity:44/153 - (28%)
Similarity:75/153 - (49%) Gaps:19/153 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   791 QQYHQQAKHPSPSQQLAAAAHAYAHATADTDSSATPR----YDF-SQYVPIQTLEVRRRYKTEFE 850
            |:.|....:|...:....|.|             ||:    .|: ::|..|:|.|.|.:||..|.
Zfish   398 QKTHTAVSNPKVVKGHIPAGH-------------TPKPVIMPDYVAKYPAIRTDEQRDQYKAVFN 449

  Fly   851 SDYDEYRKLLTRVEDVRNRFQDLSERLESARRCDNGYGDYDHIKRQIVCEYERINNDRTIGEDKE 915
            ..|.||::|...|:.|..:|.::...:::..:....|.:.|.|.: |:.:|::...|.:..|.||
Zfish   450 DQYSEYKELHVEVQAVLKKFDEMDVMMQNLPQNPTSYTERDRINK-ILQDYQKKKMDPSFLEKKE 513

  Fly   916 RFDYLHAKLAHIKQLVMDYDKTL 938
            |.:||..||:||||.:.:|||.:
Zfish   514 RCEYLKNKLSHIKQRIHEYDKVM 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 32/98 (33%)
marveld2aXP_005155591.1 MARVEL 168..350 CDD:279608
Occludin_ELL 435..533 CDD:284669 32/98 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4796
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170004at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24840
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.