DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and marveld2

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_001017292.1 Gene:marveld2 / 550046 XenbaseID:XB-GENE-5839559 Length:568 Species:Xenopus tropicalis


Alignment Length:210 Identity:52/210 - (24%)
Similarity:88/210 - (41%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 NGQRQRSASGSNSGYQQVPPPSSNSRSSIQQQNQHQKQQVQQKQAPSQQQQQQQQQYHQQ----- 796
            :.:::|...|......|:.||  .....:...|.|      ....|.||:..::.:...:     
 Frog   382 SARKRREFLGQEMNPNQISPP--KVMREVALGNGH------MIDVPDQQRDMRKVEMKPELLSGY 438

  Fly   797 --AKH-PSPSQQLAAAAHAYAHATADTDSSATPRYDFSQYVPIQTLEVRRRYKTEFESDYDEYRK 858
              |.| |.|                    ...|.| .::|..|:..:.|.|||..|...:.||::
 Frog   439 IPAGHIPKP--------------------IVMPDY-VAKYQAIKAEDERERYKAVFNDQFAEYKE 482

  Fly   859 LLTRVEDVRNRFQDLSERLESARRCDNGYGDYDHIKRQIVCEYERINNDRTIGEDKERFDYLHAK 923
            |...|:.|..:|.:|...::...|......:|:.|.: ::.||::..|:.|..|.|||.:||..|
 Frog   483 LHAEVQAVMKKFSELDAVMQKLPRNPENQHEYERIAK-VLQEYQKKKNEPTFLEKKERCEYLKNK 546

  Fly   924 LAHIKQLVMDYDKTL 938
            |:||||.:.:|||.:
 Frog   547 LSHIKQRIQEYDKVM 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 32/98 (33%)
marveld2NP_001017292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..163
MARVEL 202..371 CDD:279608
Occludin_ELL 460..558 CDD:284669 32/98 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8681
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170004at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48969
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.