DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and oclnb

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:XP_005171901.1 Gene:oclnb / 494075 ZFINID:ZDB-GENE-041212-43 Length:471 Species:Danio rerio


Alignment Length:156 Identity:36/156 - (23%)
Similarity:69/156 - (44%) Gaps:17/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 QQQQYHQQAKH-PSPSQQLAAAAHAY-----AHATADTDSSATPRYDFSQYVPIQTLEVRRRYKT 847
            |...|.|:..: ||.:..|.::....     |:...::.......|: ::|.||...:.|..||.
Zfish   321 QPMVYSQKPIYLPSSASDLTSSVSGLKGKLRAYDAGESGDELDTEYE-TEYPPIINEQERLEYKR 384

  Fly   848 EFESDYDEYRKLLTRVEDVRNRFQDLSERLESARRCDNGYGDYDHIKRQIVCEYERINNDRTIGE 912
            :|:.|:..|::|...::|:.....|....|:   |.:.|...:    ..::.||.|:.:.:...:
Zfish   385 DFDRDHMVYKRLQAELDDINQGLADADRELD---RLEEGSPQF----MDVMDEYNRLKSLKKSTD 442

  Fly   913 ---DKERFDYLHAKLAHIKQLVMDYD 935
               .|.:...|.:||:.||:.|.|||
Zfish   443 YQMKKRKCKQLKSKLSLIKRRVSDYD 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 24/101 (24%)
oclnbXP_005171901.1 DUF4446 244..>273 CDD:291263
Occludin_ELL 373..468 CDD:284669 24/101 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.