DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and Marveld2

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:XP_008758901.1 Gene:Marveld2 / 365657 RGDID:1306909 Length:559 Species:Rattus norvegicus


Alignment Length:187 Identity:50/187 - (26%)
Similarity:87/187 - (46%) Gaps:16/187 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 QQVPPPSSNSRSSIQQQNQHQKQQVQQKQAPSQQQQQQQQQYHQQAKHPSPSQQLAAAAHAYAHA 816
            |::..||.:|           |:::|.:.|.|.:|:.|:..:.:.......:.:|.:......|.
  Rat   381 QEINDPSLSS-----------KRRMQCEVATSDRQKDQEVNFKELRTTTKMAPELLSGHIPPGHI 434

  Fly   817 TADTDSSATPRYDFSQYVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERLESAR 881
            ....   ..|.| .::|..|||.:.|.|||..|:..:.||::|...|:....:|.:|...:....
  Rat   435 PKPI---VMPDY-VAKYPVIQTDDDRERYKAVFQDQFSEYKELSAEVQATLRKFDELDTVMSRLP 495

  Fly   882 RCDNGYGDYDHIKRQIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVMDYDKTL 938
            .......:::.|.| |..|:.:..||.:..|.|||.:||..||:||||.:.:|||.:
  Rat   496 HHSENRQEHERISR-IHEEFRKKKNDPSFLEKKERCEYLKNKLSHIKQRIQEYDKVM 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 32/98 (33%)
Marveld2XP_008758901.1 MARVEL 185..361 CDD:279608
Occludin_ELL 450..548 CDD:284669 32/98 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339969
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170004at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.