DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and Ell3

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_666085.2 Gene:Ell3 / 269344 MGIID:2673679 Length:395 Species:Mus musculus


Alignment Length:295 Identity:70/295 - (23%)
Similarity:120/295 - (40%) Gaps:47/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 ASSSTTP-PKLAASFVPAATSGSASGTS--------KQRMPPQQSDYNSYNSNNAQHVASNSKKR 726
            |:..|.| |.||...:...|..|.|...        .|..|.:.||  ...|::.|.:..:|.:.
Mouse   114 AAMDTIPAPLLAQEHLTEGTRESESWQDTGDEPEGHPQLAPDEVSD--PLASHHEQSLPGSSSEP 176

  Fly   727 MGSVGPSGGSNGQRQRSASGSNSGYQQVPPPSSNSRSSIQQQNQHQKQQVQQK------------ 779
            |...       ..|..:...|....|.:..|:|..|...::......::.::|            
Mouse   177 MAQW-------EMRNHTYLPSREPDQSLLSPASQKRLDKKRSAPITTEEPEEKRLRALPLASSPL 234

  Fly   780 QAPSQQQQQQQQQYHQQAKHPSP-------SQQLAAAAHAYAHATADTDSSATPRYDFSQYVPIQ 837
            |..:.|..|:.:.:.|.......       .|.|:|.:     |:........|.| ..||..|.
Mouse   235 QGLANQDSQEGEDWGQDEDEEGDEDGDSRLEQSLSAPS-----ASESPSPEEVPDY-LLQYRAIH 293

  Fly   838 TLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERLESARRCDNGYGDYDHIKRQIVCEYE 902
            :.|.::.|:.:||:||.|||.|..||.....||.:|...:   :|...|..::..::.:||.||:
Mouse   294 STEQQQAYEQDFETDYAEYRILHARVGAASQRFTELGAEI---KRLQRGTPEHKVLEDKIVQEYK 355

  Fly   903 RINND-RTIGEDKERFDYLHAKLAHIKQLVMDYDK 936
            :.... .:..|:|.|.:|||.||:|||.|::::::
Mouse   356 KFRKRYPSYREEKHRCEYLHQKLSHIKGLILEFEE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 34/99 (34%)
Ell3NP_666085.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..177 10/49 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..281 14/96 (15%)
Occludin_ELL 292..389 CDD:284669 34/99 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836306
Domainoid 1 1.000 79 1.000 Domainoid score I8640
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43800
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.