DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and MARVELD2

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_001033692.2 Gene:MARVELD2 / 153562 HGNCID:26401 Length:558 Species:Homo sapiens


Alignment Length:192 Identity:51/192 - (26%)
Similarity:87/192 - (45%) Gaps:27/192 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 QQVPPPSSNSRSSIQQQ----NQHQKQQVQQKQAPSQQQQQQQQQYHQQAKH-PSPSQQLAAAAH 811
            |::..||.:|:..:.:.    ::.:..:|..|:..:.:.:.:....|....| |.|         
Human   381 QEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKP--------- 436

  Fly   812 AYAHATADTDSSATPRYDFSQYVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSER 876
                       ...|.| .::|..|||.:.|.|||..|:..:.||::|...|:.|..:|.:|...
Human   437 -----------IVMPDY-VAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAV 489

  Fly   877 LESARRCDNGYGDYDHIKRQIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVMDYDKTL 938
            :...........:::.|.| |..|:::..||.|..|.|||.|||..||:||||.:.:|||.:
Human   490 MSRLPHHSESRQEHERISR-IHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVM 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 35/98 (36%)
MARVELD2NP_001033692.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..145
MARVEL 185..361 CDD:279608
Occludin_ELL 449..547 CDD:284669 35/98 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146204
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4796
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170004at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.