DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and OCLN

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:NP_001192183.1 Gene:OCLN / 100506658 HGNCID:8104 Length:522 Species:Homo sapiens


Alignment Length:264 Identity:56/264 - (21%)
Similarity:97/264 - (36%) Gaps:66/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 ASGTSKQRMPPQQSDYNSYNSNNAQHVASNSKKRMGSVGPSG-GSNGQRQRSASGSNSGYQQVPP 756
            ::||  |.:|...|||               .:|:.|  |.. .|||:.........|.|:..|.
Human   302 SAGT--QDVPSPPSDY---------------VERVDS--PMAYSSNGKVNDKRFYPESSYKSTPV 347

  Fly   757 PSSNSRSSIQQQNQHQKQQVQQKQAPSQQQQQQQQQYHQQAKHPSPSQQLAAAAHAYAHATADTD 821
            |                :.||:....|.....:|.:|.......:||::..|...|......:.|
Human   348 P----------------EVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQD 396

  Fly   822 SSATPRYDFS---------------QYVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQ 871
            ...|   |::               :|.||.:.:.|:.||..|::...||:.|.:.::::.....
Human   397 HYET---DYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELS 458

  Fly   872 DLSERLESARRCDNGY----GDYDHIKRQIVCEYERINNDRTIGEDKERFDYLHAKLAHIKQLVM 932
            .|.:.|:..|.....|    .:|:.:|        ::.........|.....|.:||:|||::|.
Human   459 RLDKELDDYREESEEYMAAADEYNRLK--------QVKGSADYKSKKNHCKQLKSKLSHIKKMVG 515

  Fly   933 DYDK 936
            |||:
Human   516 DYDR 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 23/102 (23%)
OCLNNP_001192183.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
MARVEL 58..263 CDD:279608
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..407 9/49 (18%)
Occludin_ELL 423..518 CDD:284669 23/102 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.