DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(Tpl) and si:ch73-61d6.3

DIOPT Version :9

Sequence 1:NP_001163477.1 Gene:Su(Tpl) / 40171 FlyBaseID:FBgn0014037 Length:1059 Species:Drosophila melanogaster
Sequence 2:XP_001341204.3 Gene:si:ch73-61d6.3 / 100001136 ZFINID:ZDB-GENE-091204-109 Length:532 Species:Danio rerio


Alignment Length:258 Identity:59/258 - (22%)
Similarity:104/258 - (40%) Gaps:59/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 ASGTSKQRMPPQQSDYNSYNSNNAQHVASNSKKRMGSVGPSGGSN--GQRQRS---ASGSNSGYQ 752
            ||....::|.|..:...|..|..|         :.|||..|...|  |..:||   .|...|..:
Zfish   318 ASMVFSEKMSPVLASAPSVGSIPA---------KTGSVFSSENHNVIGYPERSFSRPSHCTSPSR 373

  Fly   753 QVPPPSSNSRSSIQQQNQHQKQQVQQKQAPSQQQQQQQQQYHQQAKHPSPSQQLAAAAHAYAHAT 817
            :|....|:...:|::.:..:.:  ::::.|...:.|.:.:|....:                  |
Zfish   374 EVSSSPSDQTDTIRKPSAGRGK--RRRRNPELDESQYETEYTTGGE------------------T 418

  Fly   818 ADTDSSATPRYDFSQ------YVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSER 876
            ||         ||.|      |..|.:...|..||.||::|...|::|...::|:.::...||..
Zfish   419 AD---------DFDQDLWTRLYPEITSDPQRHDYKKEFDTDLRSYKELCAEMDDINDQINKLSRE 474

  Fly   877 LESARRCDNGYGDYDHIKRQIVCEYERINNDRTIGE---DKERFDYLHAKLAHIKQLVMDYDK 936
            |::   .|.|...|..:..    ||.|:.:.:.:.:   .|.:...|..||.|||::|.:||:
Zfish   475 LDT---LDEGTSKYQAVAE----EYNRLKDLKRMPDYQNKKHQCRKLRHKLFHIKRMVKNYDR 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(Tpl)NP_001163477.1 ELL 16..460 CDD:287376
Occludin_ELL 836..935 CDD:284669 27/101 (27%)
si:ch73-61d6.3XP_001341204.3 DUF3824 <5..61 CDD:289625
MARVEL 56..271 CDD:279608
Occludin_ELL 434..529 CDD:284669 27/101 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.