powered by:
Protein Alignment Mi-2 and Phf21b
DIOPT Version :9
Sequence 1: | NP_001014591.1 |
Gene: | Mi-2 / 40170 |
FlyBaseID: | FBgn0262519 |
Length: | 1983 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008763907.2 |
Gene: | Phf21b / 300117 |
RGDID: | 1308739 |
Length: | 540 |
Species: | Rattus norvegicus |
Alignment Length: | 61 |
Identity: | 28/61 - (45%) |
Similarity: | 34/61 - (55%) |
Gaps: | 2/61 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 437 HQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITW 497
|.|||..||.|..|..|.:|..|||..||:|||.|.|.|.|.||:|....| |.::.:.|
Rat 352 HDEFCAACKRGASLQPCGTCSGAYHLSCLDPPLKTAPKGVWVCPKCQRKAL--KKDEGVPW 410
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0383 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.