DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and USP3

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_006528.2 Gene:USP3 / 9960 HGNCID:12626 Length:520 Species:Homo sapiens


Alignment Length:420 Identity:101/420 - (24%)
Similarity:159/420 - (37%) Gaps:143/420 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   635 SRLATVRQVGEFLCEQLRLKSEDIRLWHVPQLDNGAILLEEDAMCLKELLIRDNDQL---LLEIR 696
            ::|..|::|.|                |:..|:|.|...:..    |:..:.:|..|   ||::.
Human   106 TKLGLVQKVRE----------------HLQNLENSAFTADRH----KKRKLLENSTLNSKLLKVN 150

  Fly   697 NKDLTWPEELGSLATAQCGQGAGTPGDRRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFN 761
                      || .||.|                         ||||.||||||||||.||.|.|
Human   151 ----------GS-TTAIC-------------------------ATGLRNLGNTCFMNAILQSLSN 179

  Fly   762 TQPLAQYFQREMHRFEVNAANKLG-----TKGQ------LAMRYAELLKEVWTATTRSVAPLKLR 815
            .:....|| :|:...|:......|     |:.|      |...:.:.|..:|..:..:.:|..|.
Human   180 IEQFCCYF-KELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLF 243

  Fly   816 FCVNKYAPQFAGGGQHDSQELLEWLLDALHEDL----NRVMEKPYSELKDSNGRPDKIVAAEAWS 876
            :.|.|..|.|.|..|.|:.|.:.:|||.||.:|    |.|......:...:....:|.....|  
Human   244 YVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNKCCINGA-- 306

  Fly   877 QHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLPVENYIYFEVLVILLDGSVPI 941
                  .:::..:|.|.|:::|:||.||.||.:||||..|||.:|                    
Human   307 ------STVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIP-------------------- 345

  Fly   942 KYGFRLNSDCKYSHLKHKLS------TMCSLPPNLMLVCELWNSQIRQVLNDDE-------KLRT 993
                        |..:.|.|      .:|||...|....:|      :.|::.|       |.:.
Human   346 ------------SQFRSKRSKNQENGPVCSLRDCLRSFTDL------EELDETELYMCHKCKKKQ 392

  Fly   994 QSAKELYVYQLPEQSMRTRSNSGLSMHIEQ 1023
            :|.|:.::.:||:.         |.:|:::
Human   393 KSTKKFWIQKLPKV---------LCLHLKR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 97/397 (24%)
Peptidase_C19 <1480..1737 CDD:351799
USP3NP_006528.2 zf-UBP 29..105 CDD:307999
UCH 159..508 CDD:306860 82/311 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.