DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and USP2

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_004196.4 Gene:USP2 / 9099 HGNCID:12618 Length:605 Species:Homo sapiens


Alignment Length:416 Identity:116/416 - (27%)
Similarity:181/416 - (43%) Gaps:88/416 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   706 LGSLATAQCGQGAGTPGDRRRLT--RSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQY 768
            :|.....:.|:|. .||..|..:  |..:.|..|.|..||.|||||||||:.||.|.||:.|..|
Human   231 IGRYTLWETGKGQ-APGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDY 294

  Fly   769 -----FQREMHRFEVNAANKLGTKGQLAM--RYAELLKEVWTATTRS-VAPLKLRFCVNKYAPQF 825
                 :.|::|.         |:....|:  .:|:|::.:||::... |:|.:.:..:.:|||:|
Human   295 CLQRLYMRDLHH---------GSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRF 350

  Fly   826 AGGGQHDSQELLEWLLDALHEDLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLF 890
            .|..|.|:||.|.:|||.||.::|||..:|.|..::.:..||.....:.|.::..|..|.|.|||
Human   351 VGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLF 415

  Fly   891 YGQLKSKVSCLGCGHESVRFDPFSLLSLPLPVENYIYFEVLVILLDGSVPIKYGFRLNSDCKYSH 955
            .|||||.::|..||:.|..||||..||||:....|.  ||.::                ||....
Human   416 VGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYP--EVTLM----------------DCMRLF 462

  Fly   956 LKHKLSTMCSLPPNLMLVCELWNSQIRQVLNDDEKL-------RTQSAKELYVYQLPEQSMRTRS 1013
            .|                        ..||:.|||.       |.:..|:..:.:.|:.      
Human   463 TK------------------------EDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKI------ 497

  Fly  1014 NSGLSMHIEQGLKDIQRSSALITSAQDSLSSLS----TLQTSSHRASSRVLCNGHVSGLDVEGE- 1073
               |.:|:::..:...|:|.|.|.....|..|.    ..:.::|...:....:.| ||..:.|. 
Human   498 ---LVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNH-SGTTMGGHY 558

  Fly  1074 ----AEVGTDVSQCNSNSNYNPIVST 1095
                ...||......::|:..|:.|:
Human   559 TAYCRSPGTGEWHTFNDSSVTPMSSS 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 97/312 (31%)
Peptidase_C19 <1480..1737 CDD:351799
USP2NP_004196.4 Necessary for interaction with MDM4. /evidence=ECO:0000269|PubMed:19838211 1..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..107
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..264 7/27 (26%)
UCH 266..596 CDD:278850 106/380 (28%)
Peptidase_C19R 268..597 CDD:239139 106/378 (28%)
Necessary for interaction with MDM4. /evidence=ECO:0000269|PubMed:19838211 403..503 39/150 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283205at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.