DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and UBP8

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_013950.1 Gene:UBP8 / 855263 SGDID:S000004836 Length:471 Species:Saccharomyces cerevisiae


Alignment Length:541 Identity:115/541 - (21%)
Similarity:177/541 - (32%) Gaps:244/541 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly  1293 SYFLSYHKTRPSLFGVPLLIPNSEGGTHKDLYCAVWLQVSRLLSPLPATTEQANHAADCDDSLG- 1356
            |:|||:.|....:||:     ||..|.   |:|                       ..|:|.:| 
Yeast    72 SHFLSHSKQIGHIFGI-----NSNNGL---LFC-----------------------FKCEDYIGN 105

  Fly  1357 ------------YDFPFTLRAV----KADGLTCAI-----CPWSS----------FCR------- 1383
                        :|...|...|    :.|||:..|     |..||          |.|       
Yeast   106 IDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIH 170

  Fly  1384 --GCEIR-------CNNDYV---LQGALPPINAAASNTSTP-------------KMNAKFPSLPN 1423
              .|::|       |..|.:   |.|||....|::|:|||.             |:|........
Yeast   171 SNNCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQ 235

  Fly  1424 LEAKRTPEYTASLSYTPTTKYFEDFTIAIDWDPTA--------------LHLRYQSTLERLWVDH 1474
            .:|....::..:       :..:.:.:.:   |.|              :|..::.:||      
Yeast   236 QDAHEFWQFIIN-------QIHQSYVLDL---PNAKEVSRANNKQCECIVHTVFEGSLE------ 284

  Fly  1475 ETIAI-----SRREQVEP-VDLN----------HCLRAFTSEEKLEQW-YHCSHCKGKKPATKKL 1522
            .:|..     :.:..::| :||:          .||.:|..:|:|:.: |||..|...:.|.|:|
Yeast   285 SSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCGECNSTQDAIKQL 349

  Fly  1523 QIWKLPPILIVHLKRF-NCVNGKWVKSQKVVHFPFDDFDPTPYLASVPQETILRHKELLELKNDA 1586
            .|.|||.:|::.|||| :.:||...|....:.||                      ..|.:||..
Yeast   350 GIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFP----------------------TYLNMKNYC 392

  Fly  1587 EMTMATNEVVSELDEIDAPSKEVKEELPNQTGSTKATASPPPTGNILRQSKTKNAVRRQRLISTS 1651
                                            |||.                             
Yeast   393 --------------------------------STKE----------------------------- 396

  Fly  1652 LTKTPIVDGEFEDYHQHRLK-PDVDQFDPRYRLYAVVSHSGMLNGGHYISYASNATGSWYCYNDS 1715
                       :|.|....| ||:     .|.|..:|||.|.:|.||||::...:.|.|:.:|||
Yeast   397 -----------KDKHSENGKVPDI-----IYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDS 445

  Fly  1716 SCREISQKPVIDPSAAYLLFY 1736
            ....|||:.|: ...||||||
Yeast   446 MVSSISQEEVL-KEQAYLLFY 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847
Peptidase_C19 <1480..1737 CDD:351799 66/271 (24%)
UBP8NP_013950.1 zf-UBP 46..108 CDD:396634 15/66 (23%)
Peptidase_C19D 138..466 CDD:239125 94/444 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.