DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and usp8

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:XP_009291628.1 Gene:usp8 / 565434 ZFINID:ZDB-GENE-030131-1949 Length:1067 Species:Danio rerio


Alignment Length:333 Identity:106/333 - (31%)
Similarity:162/333 - (48%) Gaps:36/333 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   686 RDNDQLLLEIRNKDLTWPEELGSLATAQCGQGAGTPGDRR-------------RLTRSSIMSV-- 735
            |:..:|.....:.|::  :|| |..|.|  :.|..|...|             .:||.|...:  
Zfish   663 REQSKLKRSYSSPDIS--QEL-SAETRQ--RPAAVPSINRENKPLAASTYAKVEITRPSAAKIRN 722

  Fly   736 -------HAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKLGTKGQLAMR 793
                   ..|..|||.||||||:||:.||.|.||..:|.||.|..::.::|.||.||.||::|..
Zfish   723 LNPVFGGQGPLLTGLRNLGNTCYMNSILQCLCNTVAMADYFNRNYYQDDINRANILGHKGEVAEE 787

  Fly   794 YAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDLNRV-MEKPYS 857
            ::.::|.:|....:.::||..:..:.|...:|:.....||||||.:|:|.||||||:. ..:.|.
Zfish   788 FSVVMKALWLGQYKMISPLDFKGTICKINSRFSSYEHQDSQELLLFLMDGLHEDLNKADKRRGYK 852

  Fly   858 ELKDSNGRPDKIVAAE-AWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLP 921
            |  :.....|.:.||: |||:|...|:|||:.||.||.||.|.|:.|.|:|..|:.|..|:|.:.
Zfish   853 E--EEIEHLDDVSAADLAWSKHKQLNESIIVALFQGQFKSTVQCMSCQHKSRTFETFMYLTLEMT 915

  Fly   922 VENYIYFEVLVILLDGSVPIKYGFRLN-SDCKYSHLKHKLSTMCSLPPNLMLVCELWNSQIRQVL 985
            ..:....:..:.|......:..|.|.. ..||......|...:..|||.|::..:.:..:.|.  
Zfish   916 ASSKCSLQDCLKLFHKEERLTDGNRFYCRHCKTHRDAIKRMQIWKLPPILLVHLKRFKYEGRW-- 978

  Fly   986 NDDEKLRT 993
              .|||:|
Zfish   979 --REKLQT 984

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 106/333 (32%)
Peptidase_C19 <1480..1737 CDD:351799
usp8XP_009291628.1 USP8_dimer 8..115 CDD:312504
RHOD 175..306 CDD:320771
Atrophin-1 <316..644 CDD:331285
UCH 735..1064 CDD:306860 91/256 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.