DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and Usp27x

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_062334.2 Gene:Usp27x / 54651 MGIID:1859645 Length:438 Species:Mus musculus


Alignment Length:375 Identity:91/375 - (24%)
Similarity:140/375 - (37%) Gaps:94/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   724 RRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKLGTKG 788
            |||:..|..:     |..||.|||||||||..:|.|.:|..|..:|..:.||.|:.:....    
Mouse    66 RRRIASSFTI-----GLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELC---- 121

  Fly   789 QLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALH-----EDL 848
             |....:.|.:|:::.......|.||...|..:|...||..|.|:.|.|...||.||     :|:
Mouse   122 -LVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDV 185

  Fly   849 NRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPF 913
            .:|...|                      :|.  ..||..:|.|.|:|.|:|..|...|...||.
Mouse   186 GKVASNP----------------------NHC--NCIIDQIFTGGLQSDVTCQACHGVSTTIDPC 226

  Fly   914 SLLSLPLPVENYIYFEV---LVILLDGSVPIKYGFRLNSDC-----KYSHLKHKLSTMCSLPPNL 970
            ..:||.||.....::.:   ....|:|...|. |....:||     :..||.......|.     
Mouse   227 WDISLDLPGSCTSFWPMSPGRESSLNGESHIP-GITTLTDCLRRFTRPEHLGSSAKIKCG----- 285

  Fly   971 MLVCELWNSQIRQVLNDDEKLRTQSAKELYVYQLP----------EQS--MRTRSNSGLSMHIEQ 1023
              .|:.:.               :|.|:|.:.:||          |.|  .|.:..:.:|..:|.
Mouse   286 --SCQSYQ---------------ESTKQLTMKKLPVVACFHFKRFEHSAKQRRKITTYISFPLEL 333

  Fly  1024 GLKDIQRSS---------ALITSAQDSLSSLSTLQTSSHRASSRVLCNGH 1064
            .:.....||         .|.|::.::.:..|.....:|:.:   |.:||
Mouse   334 DMTPFMASSKETRVNGQLQLPTNSANNENKYSLFAVVNHQGT---LESGH 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 75/290 (26%)
Peptidase_C19 <1480..1737 CDD:351799
Usp27xNP_062334.2 UCH 77..418 CDD:278850 86/359 (24%)
Peptidase_C19D 78..419 CDD:239125 86/358 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.