DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and TBC1D3B

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:XP_005258037.2 Gene:TBC1D3B / 414059 HGNCID:27011 Length:610 Species:Homo sapiens


Alignment Length:63 Identity:19/63 - (30%)
Similarity:24/63 - (38%) Gaps:14/63 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 PKSLWKALNRWYGDNLP-LPRQVIQPPNSDVELELYPLNLRILLHQAQPSQTGVGGGTQLGSW 595
            |:.:|.|       :.| .||.....|...|..:.||:..     |..||.....||.| |||
Human   459 PRPIWSA-------SPPRAPRSSTPCPGGAVREDTYPVGT-----QGVPSPALAQGGPQ-GSW 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 19/63 (30%)
Peptidase_C19 <1480..1737 CDD:351799
TBC1D3BXP_005258037.2 TBC 160..373 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104647
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.