powered by:
Protein Alignment Usp32 and TBC1D3B
DIOPT Version :9
Sequence 1: | NP_001262074.2 |
Gene: | Usp32 / 40169 |
FlyBaseID: | FBgn0036913 |
Length: | 1779 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005258037.2 |
Gene: | TBC1D3B / 414059 |
HGNCID: | 27011 |
Length: | 610 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 19/63 - (30%) |
Similarity: | 24/63 - (38%) |
Gaps: | 14/63 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 534 PKSLWKALNRWYGDNLP-LPRQVIQPPNSDVELELYPLNLRILLHQAQPSQTGVGGGTQLGSW 595
|:.:|.| :.| .||.....|...|..:.||:.. |..||.....||.| |||
Human 459 PRPIWSA-------SPPRAPRSSTPCPGGAVREDTYPVGT-----QGVPSPALAQGGPQ-GSW 508
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104647 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.