DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and not

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_001287106.1 Gene:not / 40030 FlyBaseID:FBgn0013717 Length:496 Species:Drosophila melanogaster


Alignment Length:492 Identity:113/492 - (22%)
Similarity:174/492 - (35%) Gaps:140/492 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   644 GEFLCEQLRLKSEDIRLWHVPQLDNGAILLEE------DAMCLKELLIRDNDQLLLEIRNKDLTW 702
            |..:...||.|..::.|    :|.:|.:....      ||...:..||  |.:|..:...|.:.|
  Fly    69 GAHITSHLRSKKHNVAL----ELSHGTLYCYACRDFIYDARSREYALI--NRKLEAKDLQKSIGW 127

  Fly   703 -------PEELGSLATAQCGQGAGTPGDRRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLF 760
                   .|....||.|           ||||.|.:    ...|..||.|||.|||||..:|.|.
  Fly   128 VPWVPTTKETNLLLANA-----------RRRLVRPN----QTIGLRGLLNLGATCFMNCIVQALV 177

  Fly   761 NTQPLAQYFQREMHRFEVNAANKLGTKGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQF 825
            :|..|:.||..:.|.....:::|.     |....:.|.:|.::.:...::..:|...:..:|...
  Fly   178 HTPLLSDYFMSDRHDCGSKSSHKC-----LVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHL 237

  Fly   826 AGGGQHDSQELLEWLLDALHEDLNRVMEKPYSELK-DSNGRPDKIVAAEAWSQH-HARNQSIIID 888
            ||..|.|:.|.....||.||.  :.|..|...|.| :|:|......::.:.|.| :.:...||..
  Fly   238 AGYEQQDAHEFFIATLDVLHR--HCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQ 300

  Fly   889 LFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLPVENYIYFEVLVILLDGSVPIKYGFRLNS--DC 951
            :|.|.|:|.|.|..|...|..:|||..:||.|                |......|....:  ||
  Fly   301 IFTGMLQSDVVCQACNGVSTTYDPFWDISLDL----------------GETTTHGGVTPKTLIDC 349

  Fly   952 --KYSHLKHKLSTMCSLPPNLMLVCELWNSQIRQVLNDDEKLRTQSAKELYVYQLPEQSMRTRSN 1014
              :|:..:|                          |....|::..:.|. |.....:.|:||.. 
  Fly   350 LERYTRAEH--------------------------LGSAAKIKCSTCKS-YQESTKQFSLRTLP- 386

  Fly  1015 SGLSMHIEQGLKDIQRSSALITSAQDS-------------------------------LSSLSTL 1048
            |.:|.|:::     ...||||.....|                               ::.:.|:
  Fly   387 SVVSFHLKR-----FEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFRFSLYAVVNHVGTI 446

  Fly  1049 QTS------SHRASSRVLCNGHV-------SGLDVEG 1072
            .|.      .|:..:.|.|:.||       ..||.||
  Fly   447 DTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEG 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 91/376 (24%)
Peptidase_C19 <1480..1737 CDD:351799
notNP_001287106.1 zf-UBP 46..103 CDD:307999 7/37 (19%)
Peptidase_C19D 158..489 CDD:239125 88/382 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21646
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.