DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and USP27X

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_001138545.1 Gene:USP27X / 389856 HGNCID:13486 Length:438 Species:Homo sapiens


Alignment Length:459 Identity:107/459 - (23%)
Similarity:155/459 - (33%) Gaps:110/459 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   678 MCLKELLIRDNDQLLLEIRNKDLTWPEELGSLATAQCGQGAGTPG-------------------- 722
            ||...:..:|.:|:..|.:.:.|   :...|.:|....|....||                    
Human     1 MCKDYVYDKDIEQIAKEEQGEAL---KLQASTSTEVSHQQCSVPGLGEKFPTWETTKPELELLGH 62

  Fly   723 --DRRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKLG 785
              .|||:|.|..:     |..||.|||||||||..:|.|.:|..|..:|..:.||.|:.:.... 
Human    63 NPRRRRITSSFTI-----GLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELC- 121

  Fly   786 TKGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALH----- 845
                |....:.|.:|:::.......|.||...|..:|...||..|.|:.|.|...||.||     
Human   122 ----LVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKG 182

  Fly   846 EDLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRF 910
            :|:.:....|                      :|.  ..||..:|.|.|:|.|:|..|...|...
Human   183 DDVGKAANNP----------------------NHC--NCIIDQIFTGGLQSDVTCQACHGVSTTI 223

  Fly   911 DPFSLLSLPLP----------------VENYIYFEVLVILLD------------GSVPIKYGFRL 947
            ||...:||.||                |....:...:..|.|            .|..||.|   
Human   224 DPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCG--- 285

  Fly   948 NSDCKYSHLKHKLSTMCSLPPNLMLVCELWNSQIRQVLNDDEKLRTQSAKELYVYQLP--EQSMR 1010
              .|:......|..||..||   ::.| ....:.........|:.|..:..|.:...|  ..|..
Human   286 --SCQSYQESTKQLTMNKLP---VVAC-FHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKE 344

  Fly  1011 TRSNSGLSMHIEQGLKDIQRSSALITSAQDSLSSLSTLQTSSHRASSRVLCNGHV-------SGL 1068
            :|.|..|.:....|..:.:.|...:.:.|.:|.|........|.......|:..|       ..|
Human   345 SRMNGQLQLPTNSGNNENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVL 409

  Fly  1069 DVEG 1072
            |.||
Human   410 DSEG 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 90/378 (24%)
Peptidase_C19 <1480..1737 CDD:351799
USP27XNP_001138545.1 Peptidase_C19D 78..419 CDD:239125 90/374 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.