DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and Usp39

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_573334.1 Gene:Usp39 / 32881 FlyBaseID:FBgn0030969 Length:494 Species:Drosophila melanogaster


Alignment Length:414 Identity:83/414 - (20%)
Similarity:142/414 - (34%) Gaps:129/414 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   735 VHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYF-QREMHRFEVN-AANKLGTKGQLAMRYAEL 797
            ::.||..||:|:....:.|..|..|.:..||..|| |::.:...|. ..:.:.|   |..|:.||
  Fly   153 LYLPGVVGLNNIKANDYCNVVLHALSHVGPLRDYFLQKQSYAHVVRPPGDSVFT---LVQRFGEL 214

  Fly   798 LKEVWTATT--RSVAPLK-LRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDLNRVMEKPYSEL 859
            ::::|....  ..|:|.: |:..|...:.:|....|.|..:.|.|.|:.||..|.          
  Fly   215 MRKMWNPRNFKSHVSPHEMLQAVVLWSSKRFQITEQGDPIDFLSWFLNTLHRALK---------- 269

  Fly   860 KDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLPVEN 924
              .|..|               |.||:..:|.|::|                 .....:| ||| 
  Fly   270 --GNKHP---------------NSSILYKIFLGEMK-----------------IYTRKMP-PVE- 298

  Fly   925 YIYFEVLVILLDGSVPIKYGFRLNSDCKYSHL---KHKLSTMCSLPPNLMLVCELWNSQIRQV-- 984
                      ||.:...    :|.:..:|...   |:.:...|.|||..:...|...:.|.||  
  Fly   299 ----------LDDAAKA----QLLATEEYKDQVEDKNFIYLTCDLPPPPLFTDEFRENIIPQVNL 349

  Fly   985 ------LND--DEKLRTQSAKELYVYQLPEQSMRTRSNSGLSMHIEQGLKD---IQRSSALITSA 1038
                  .|.  :::.:|..|..:..:::      ||....:.::|::..|:   ::::..::...
  Fly   350 YQLLSKFNGTAEKEYKTYKANFMKRFEI------TRLPQFIILYIKRFTKNTFFLEKNPTIVNFP 408

  Fly  1039 QDSLSSLSTLQTSSHRASSRVLCNGHVSGLDVEGEAEVGTDVSQCNSNSNYN------PIVSTY- 1096
            ..                       ||...|:.|..:...||.....|...|      |...|| 
  Fly   409 IK-----------------------HVDFGDILGMRQRDKDVKDTKYNLVANIVHDGDPKKGTYR 450

  Fly  1097 -----SGNGS----GDNQVHELLP 1111
                 ..||.    .|..|.|:||
  Fly   451 AHILHKANGQWYEMQDLHVTEILP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 61/284 (21%)
Peptidase_C19 <1480..1737 CDD:351799
Usp39NP_573334.1 Peptidase_C19M 39..488 CDD:239134 83/414 (20%)
UCH 158..487 CDD:278850 81/409 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21646
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.