DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and ubp4

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_001342719.1 Gene:ubp4 / 2540837 PomBaseID:SPBC18H10.08c Length:593 Species:Schizosaccharomyces pombe


Alignment Length:258 Identity:81/258 - (31%)
Similarity:120/258 - (46%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   742 GLHNLGNTCFMNAALQVLFN----TQPLAQYFQREMHRFEVNAANKLGTKGQLAMRYAELLKEV- 801
            ||.||||||:||..||.||.    |.|:.|  .|.:.: .:|..|.|||.|::...:..||:.| 
pombe   228 GLTNLGNTCYMNCVLQCLFACKDLTIPMLQ--GRGLLQ-NINTKNPLGTGGKITSAFFSLLQSVL 289

  Fly   802 WTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDLN-RVMEKPYSELKDSNGR 865
            .....||::|......|......|:..||.|:||.|.:.||.|||||| .....|.:.|.:    
pombe   290 LNHGQRSISPRNFLEIVQSLNRDFSIDGQCDAQEFLNFFLDKLHEDLNSNASRSPIAPLTE---- 350

  Fly   866 PDKIVAAE----------AWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPL 920
             |::.|.|          .|:.|...|:||:::.|.|||.|:..|:.||..|..|.||:.|::|:
pombe   351 -DQLSAREELPLSHFSHIEWNLHLRSNKSIVVNNFVGQLCSRTQCMTCGRTSTTFAPFTSLAIPI 414

  Fly   921 -PVENYIYFEVLVI------LLDG----SVPIKYGFRLNSDCKYSHLKHKLSTMCSLPPNLML 972
             .|.:.:..:..::      ||.|    ..|:         ||......|:..:..||..|::
pombe   415 DDVSHVVSLQECLLKFSAPELLQGHDGWHCPV---------CKVQRSAKKVIMISKLPEYLII 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 81/258 (31%)
Peptidase_C19 <1480..1737 CDD:351799
ubp4NP_001342719.1 COG5533 156..574 CDD:227820 81/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.