DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and Usp3

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:XP_006511173.1 Gene:Usp3 / 235441 MGIID:2152450 Length:606 Species:Mus musculus


Alignment Length:634 Identity:136/634 - (21%)
Similarity:209/634 - (32%) Gaps:225/634 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 GSGSASSGISAGRHCG----PVRPGPIDNSNLI------------------------TANPFRNV 508
            ||.:..:|.:.||.||    .|..||...|..:                        .|:|....
Mouse     9 GSANLRAGSARGRTCGGVGLAVPRGPDRQSAALRAQLCLDCRRASPFGLRFLGFPQAPASPAAPE 73

  Fly   509 RTLTGEGGHLKRDTPLVQNHDFE---LVPKSLWKALNRWYGDNLPLPRQVIQP------------ 558
            ||..| ..||......|: ..||   ..||:..||.|..:|....:.|....|            
Mouse    74 RTALG-AAHLGVSLQPVR-VKFENRLRAPKAPEKAANSCFGGAARVCRSNKSPWVCLTCSSVHCG 136

  Fly   559 --PNSDVELELYPLNLRILLHQAQPSQTGVGGGTQLGSWGSTVSGGYGVLASGGGYAAIAVSSVL 621
              .|...:.......:.:|.|:....|.               ...:.|......|:....    
Mouse   137 RYVNGHAKKHYEDAQIPLLNHKRSEKQE---------------KAQHTVCMDCSSYSTYCY---- 182

  Fly   622 QPPKRYLAYTAAFSRLATVRQVGEFLCEQLRLKSEDIRLWHVPQLDNGAI---------LLEEDA 677
                |...:....::|..|::|.|                |:..|:|.|.         |||..:
Mouse   183 ----RCDDFVVNDTKLGLVQKVRE----------------HLQNLENSAFTADRHRKRKLLENSS 227

  Fly   678 MCLKELLIRDNDQLLLEIRNKDLTWPEELGSLATAQCGQGAGTPGDRRRLTRSSIMSVHAPGATG 742
            :         |.:||            ::....||.|                         |||
Mouse   228 L---------NSKLL------------KVNGSTTAIC-------------------------ATG 246

  Fly   743 LHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKLG-----TKGQ------LAMRYAE 796
            |.||||||||||.||.|.|.:....|| :|:...|:......|     |:.|      |...:.:
Mouse   247 LRNLGNTCFMNAILQSLSNIEQFCCYF-KELPAVELRNGKTAGRRTYHTRSQGDSNVSLVEEFRK 310

  Fly   797 LLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDL----NRVMEKPYS 857
            .|..:|..:..:.:|..|.:.|.|..|.|.|..|.|:.|.:.:|||.||.:|    |.|......
Mouse   311 TLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAIL 375

  Fly   858 ELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLPV 922
            :...:....:|.....|        .:::..:|.|.|:::|:||.||.||.:||||..|||.:| 
Mouse   376 QENSTLSASNKCCINGA--------STVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIP- 431

  Fly   923 ENYIYFEVLVILLDGSVPIKYGFRLNSDCKYSHLKHKLS------TMCSLPPNLMLVCELWNSQI 981
                                           |..:.|.|      .:|||...|....:|     
Mouse   432 -------------------------------SQFRSKRSKNQENGPVCSLRDCLRSFTDL----- 460

  Fly   982 RQVLNDDE-------KLRTQSAKELYVYQLPEQSMRTRSNSGLSMHIEQ 1023
             :.|::.|       |.:.:|.|:.::.:||:         .|.:|:::
Mouse   461 -EELDETELYMCHKCKKKQKSTKKFWIQKLPK---------ALCLHLKR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 127/597 (21%)
Peptidase_C19 <1480..1737 CDD:351799
Usp3XP_006511173.1 zf-UBP 117..191 CDD:366940 9/96 (9%)
UCH 245..594 CDD:366104 82/311 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.