DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and USP22

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_056091.1 Gene:USP22 / 23326 HGNCID:12621 Length:525 Species:Homo sapiens


Alignment Length:393 Identity:100/393 - (25%)
Similarity:141/393 - (35%) Gaps:118/393 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   724 RRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAANKLGTKG 788
            ||::|.:..:     |..||.|||||||||..:|.|.:|..|..:|..:.||.|:.:.:..    
Human   164 RRKITSNCTI-----GLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSC---- 219

  Fly   789 QLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDLNRVME 853
             |....:.|.:|.::.......|.||...|..:|...||..|.|:.|.|...||.||....    
Human   220 -LVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCK---- 279

  Fly   854 KPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSL 918
                  .|.||:       :|.:.:|.  ..||..:|.|.|:|.|:|..|...|...|||..:||
Human   280 ------GDDNGK-------KANNPNHC--NCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISL 329

  Fly   919 PLP----------------VEN-----------------------------------YIYFEVLV 932
            .||                |.|                                   :.|.|...
Human   330 DLPGSSTPFWPLSPGSEGNVVNGESHVSGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTK 394

  Fly   933 ILLDGSVPIKYGFRLNSDCKYSH---LKHKLSTMCSLPPNLMLVCEL-------WNSQIRQ---V 984
            .|....:||...|.|.   ::.|   |:.|::|..|.|..|.:...:       .|.|.:|   .
Human   395 QLTMKKLPIVACFHLK---RFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDS 456

  Fly   985 LNDDEK------LRTQSAKELYVYQLPEQSMRTRSNSGLSMHIEQGLKDIQRSSALITSA--QDS 1041
            ||:|.|      :..|...|...|           .|.:..|.:|..|   ...|:||.|  :|.
Human   457 LNNDNKYSLFAVVNHQGTLESGHY-----------TSFIRQHKDQWFK---CDDAIITKASIKDV 507

  Fly  1042 LSS 1044
            |.|
Human   508 LDS 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 88/347 (25%)
Peptidase_C19 <1480..1737 CDD:351799
USP22NP_056091.1 zf-UBP 63..123 CDD:396634
Peptidase_C19D 176..518 CDD:239125 96/376 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.