DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and usp-33

DIOPT Version :9

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_510570.2 Gene:usp-33 / 181647 WormBaseID:WBGene00010702 Length:716 Species:Caenorhabditis elegans


Alignment Length:320 Identity:78/320 - (24%)
Similarity:125/320 - (39%) Gaps:69/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 KSEDIRLWHVPQLDNGAI--LLEEDAMC-------------------LKELLIRDNDQLL--LEI 695
            |..:.|..||..::...:  ||::...|                   ||....:::|.||  :.:
 Worm    62 KQMESRCKHVKDINPSDLSQLLQKKLKCMTCHDSVSFSCAHQDCINSLKSSCCKNSDHLLPHMAV 126

  Fly   696 RNKDLTWPEELGSLATAQCGQGAGTPGDRRRLTRSSIMS-------------VHAPGATGLHNLG 747
            .|.......:..|:...:|  ...|| .:|.||.:...:             :...|..|..|.|
 Worm   127 HNHPPILYHDRKSILCTRC--MVYTP-VKRFLTHTKFSTSDKVEQETRKMEPLAFRGLLGYLNFG 188

  Fly   748 NTCFMNAALQVLFNTQPLAQYFQREMHRFEV-------NAANKL-GTKGQLAMRYAELLKEVWTA 804
            |||:|||.||:|.:..|..||.      .|:       |.::.: .|..|:|:....:..:.   
 Worm   189 NTCYMNAVLQLLGHCSPFTQYL------IELIPPGGWSNCSHDIPKTAIQMALDLRNMYSDF--- 244

  Fly   805 TTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLDALHEDLNRVMEKPYSELKDSN-----G 864
            ....::|.|:..||....|.|....|.|:.|.:..|||.|..||     |..||...:|     |
 Worm   245 PLPYLSPWKIITCVRNEMPGFECFQQQDASEFMRNLLDILDRDL-----KTCSEYHRTNTLIEMG 304

  Fly   865 RPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLGCGHESVRFDPFSLLSLPLPVEN 924
            .|:...|....:.|   .::.|..:|.|.|::::.|..||..|...:.|..||:|:..||
 Worm   305 NPEMDYAIAMNAPH---TKTAISAIFQGVLENQIQCHSCGFRSRTIENFLDLSIPIVGEN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 FRQ1 186..317 CDD:227455
UBP12 486..>1002 CDD:227847 78/320 (24%)
Peptidase_C19 <1480..1737 CDD:351799
usp-33NP_510570.2 Peptidase_C19 183..546 CDD:239072 57/196 (29%)
UCH 183..545 CDD:278850 57/196 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.