DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp32 and USP18

DIOPT Version :10

Sequence 1:NP_001262074.2 Gene:Usp32 / 40169 FlyBaseID:FBgn0036913 Length:1779 Species:Drosophila melanogaster
Sequence 2:NP_059110.2 Gene:USP18 / 11274 HGNCID:12616 Length:372 Species:Homo sapiens


Alignment Length:262 Identity:57/262 - (21%)
Similarity:89/262 - (33%) Gaps:119/262 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly  1489 DLNHCL---RAFTSEEKLEQWYHCSHCKGKKPATKK-LQIWKLPPILIVHLKRFNCVNGKWVKSQ 1549
            |..||.   |..:|:.|.    .|.:| |||...|: |::..||..|.:||.||:..|.   :::
Human   211 DALHCFFQPRELSSKSKC----FCENC-GKKTRGKQVLKLTHLPQTLTIHLMRFSIRNS---QTR 267

  Fly  1550 KVVHFPFDDFDPTPYLASVPQETILRHKELLELKNDAEMTMATNEVVSELDEIDAPSKEVKEELP 1614
            |:.|..:           .||.  |...::|.:|.::                            
Human   268 KICHSLY-----------FPQS--LDFSQILPMKRES---------------------------- 291

  Fly  1615 NQTGSTKATASPPPTGNILRQSKTKNAVRRQRLISTSLTKTPIVDGEFEDYHQHRLKPDVDQFDP 1679
                                                       .|.|             :|...
Human   292 -------------------------------------------CDAE-------------EQSGG 300

  Fly  1680 RYRLYAVVSHSGMLNGGHYISYASNAT-GSWYCYNDSSCREISQKPVI----DPS-----AAYLL 1734
            :|.|:||::|.||.:.|||..|..||. |.|:|:|||:...:|.:.:.    :|:     .||||
Human   301 QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYLL 365

  Fly  1735 FY 1736
            .|
Human   366 VY 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp32NP_001262074.2 EFh_PI-PLC 198..>251 CDD:333715
EF-hand motif 198..222 CDD:320029
EF-hand_7 227..290 CDD:463900
UBP12 486..>1002 CDD:227847
Peptidase_C19 <1480..1737 CDD:470612 57/262 (22%)
USP18NP_059110.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..45
Mediates interaction with IFNAR2. /evidence=ECO:0000269|PubMed:28165510 36..51
Mediates interaction with STAT2. /evidence=ECO:0000269|PubMed:28165510 51..112
UCH 55..367 CDD:425685 56/260 (22%)
Mediates interaction with STAT2 and necessary for the negative regulation of the type I IFN signaling pathway. /evidence=ECO:0000269|PubMed:28165510 303..312 4/8 (50%)
Mediates interaction with IFNAR2. /evidence=ECO:0000269|PubMed:28165510 313..372 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.