DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB3D

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_004274.1 Gene:RAB3D / 9545 HGNCID:9779 Length:219 Species:Homo sapiens


Alignment Length:179 Identity:90/179 - (50%)
Similarity:131/179 - (73%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            :.:||:|||||||:|.||||..|||:::|:|...|:||:|||||::|:...:|:|||||||||||
Human    17 QNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQ 81

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            ||:|||||||||||||.:|:|||..::||..:::|...|:..:..:.:.:|:||||:|.|:|.|.
Human    82 ERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVP 146

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN 181
            .|.|.:||.:.|.:|.|.|||.:|||::.|..|...|..|..:.:|.::
Human   147 AEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 88/165 (53%)
RAB3DNP_004274.1 Rab3 22..186 CDD:206657 86/163 (53%)
Effector region. /evidence=ECO:0000250 51..59 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..219 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.