DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB28

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001017979.1 Gene:RAB28 / 9364 HGNCID:9768 Length:221 Species:Homo sapiens


Alignment Length:214 Identity:64/214 - (29%)
Similarity:104/214 - (48%) Gaps:10/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIEL-DNKKIKLQIWDTAG 66
            ::.|...|::::||...|||.:...|:::.|...:..|||:||.:|.|.| .|..:.|||||..|
Human     7 ESQDRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGG 71

  Fly    67 QERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNW---IRNIEENASADVEKMLLGNKCELTDK 128
            |.....:...|..||.|::||||||..:||||:::|   ::.:.|.:.......|:|||.:|...
Human    72 QTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHM 136

  Fly   129 RQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI------KAKTEKRMEANNPPKGGH 187
            |.:..|:..:...|.|......|||...:|...|..:|::|      ||:.|:...........:
Human   137 RTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNY 201

  Fly   188 QLKPMDSRTKDSWLSRCSL 206
            ..:||.........|.|::
Human   202 NQEPMSRTVNPPRSSMCAV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 58/175 (33%)
RAB28NP_001017979.1 Rab28 13..221 CDD:206694 63/208 (30%)
Effector region. /evidence=ECO:0000250 41..49 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.