DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and SEC4

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:108/204 - (52%)
Similarity:150/204 - (73%) Gaps:6/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            |:||.:.|:||||||||||:|:|.||.||.||.:||:||||||||:|::::.||:|||:||||||
Yeast    15 KSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQ 79

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            |||||||||||||||||:||||:|.|::|.|||.|.:.:.|:|:.:.:.:|:|||.:: :.|.|:
Yeast    80 ERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM-ETRVVT 143

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAK--TEKRMEANNPPKGGHQLKPMDSR 195
            .::||.||.|.||.|:|:|||...||.|.|.|||..|:.|  :.|.:...|..:|...:   :|.
Yeast   144 ADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVGNGKEGNISI---NSG 205

  Fly   196 TKDSWLSRC 204
            :.:|..|.|
Yeast   206 SGNSSKSNC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 98/165 (59%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 98/165 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 207 1.000 Domainoid score I520
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100934
Inparanoid 1 1.050 217 1.000 Inparanoid score I784
Isobase 1 0.950 - 0 Normalized mean entropy S199
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - otm46519
orthoMCL 1 0.900 - - OOG6_101252
Panther 1 1.100 - - LDO PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.