DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABA1b

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_173136.1 Gene:RABA1b / 838263 AraportID:AT1G16920 Length:216 Species:Arabidopsis thaliana


Alignment Length:187 Identity:87/187 - (46%)
Similarity:130/187 - (69%) Gaps:6/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||||::|||||||||:.:|.||:::.||....||||::|..||:::|.|.:|.||||||||||
plant    10 YDYLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLKVDGKVVKAQIWDTAGQER 74

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKE 134
            :|.||:||||||:|.:||||:|:..:|||:..|::.::.:...::..||:|||.:|.....|..|
plant    75 YRAITSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTDPNIVVMLVGNKSDLRHLLAVPTE 139

  Fly   135 RGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI-KAKTEKRMEAN-----NPPKG 185
            .|:..|.:..:.||||||..:.|||:||..:.:.| :..::|::||.     :.|||
plant   140 DGKSYAEQESLCFMETSALEATNVEDAFAEVLTQIYRITSKKQVEAGEDGNASVPKG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 80/166 (48%)
RABA1bNP_173136.1 Rab11_like 11..175 CDD:206660 79/163 (48%)

Return to query results.
Submit another query.