DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB11c

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_172434.1 Gene:RAB11c / 837490 AraportID:AT1G09630 Length:217 Species:Arabidopsis thaliana


Alignment Length:191 Identity:85/191 - (44%)
Similarity:132/191 - (69%) Gaps:6/191 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||||::|||||||||:.:|.||:.:.|.....||||::|..||::::.:.:|.||||||||||
plant     9 YDYLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQER 73

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKE 134
            :|.||:||||||:|.:||||:|:..:|||:..|::.:.::|.:::..||:|||.:|...|.|:.|
plant    74 YRAITSAYYRGALGALLVYDVTKPTTFENVSRWLKELRDHADSNIVIMLIGNKTDLKHLRAVATE 138

  Fly   135 RGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI------KAKTEKRMEANNPPKGGHQL 189
            ..:..|.:.|:.|:||||..::|||:||.|:.|::      |:.:..:..||...|.|..:
plant   139 DAQSYAEKEGLSFIETSALEALNVEKAFQTILSEVYRIISKKSISSDQTTANANIKEGQTI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 80/171 (47%)
RAB11cNP_172434.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..216 CDD:476819 85/191 (45%)

Return to query results.
Submit another query.