DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABA1c

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_199387.1 Gene:RABA1c / 834614 AraportID:AT5G45750 Length:216 Species:Arabidopsis thaliana


Alignment Length:187 Identity:87/187 - (46%)
Similarity:126/187 - (67%) Gaps:6/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||||::|||||||||:.:|.||:::.|:....||||::|..|::.:|:|.||.||||||||||
plant    10 YDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDDKVIKAQIWDTAGQER 74

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKE 134
            :|.||:||||||:|.:||||:|:..:|||::.|::.:..:...::..||:|||.:|.....|..|
plant    75 YRAITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDLRHLVAVQTE 139

  Fly   135 RGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI-KAKTEKRME-----ANNPPKG 185
            ..:..|.:..:.||||||..:.|||.||..:.:.| ...::|.||     ||.|.||
plant   140 DAKSFAEKESLYFMETSALEATNVENAFAEVLTQIHHIVSKKAMEAASESANVPSKG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 78/166 (47%)
RABA1cNP_199387.1 Rab11_like 11..175 CDD:206660 77/163 (47%)

Return to query results.
Submit another query.