DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABG1

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_568566.1 Gene:RABG1 / 833958 AraportID:AT5G39620 Length:204 Species:Arabidopsis thaliana


Alignment Length:219 Identity:83/219 - (37%)
Similarity:121/219 - (55%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |.||   ..|::|:||||||||.:|.|:::..|.....|||.:|...:.|.:..:::.|||||||
plant     1 MEKT---KLKIILLGDSGVGKTSLLKRYNDKDFKQLHNSTIYVDLVTKEICIAERQVILQIWDTA 62

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNW----IRNIEENASADVEKMLLGNKCELT 126
            |||||:::.:.:||.....:||||:...|:||:|.||    |:............:|:|||.::.
plant    63 GQERFKSLPSRFYRDTDCCVLVYDVNTLKTFESIDNWHDEFIKQANPETPTKFPFVLMGNKTDVN 127

  Fly   127 D--KRQVSKERGEQLAIEYG-IKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQ 188
            :  .|.|:||..:|.....| |.:.||||||.||||||||.:|.  ||.|.:|           |
plant   128 NGKPRVVAKEIADQWCGSKGNIVYFETSAKAKINVEEAFLEIAK--KALTNER-----------Q 179

  Fly   189 LKPMD-------SRTKDSWLSRCS 205
            :..|:       :..|::..||||
plant   180 IDDMERYRSVVPTIEKETPRSRCS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 70/172 (41%)
RABG1NP_568566.1 P-loop_NTPase 6..179 CDD:393306 73/185 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.