DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABC2A

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_568121.1 Gene:RABC2A / 831810 AraportID:AT5G03530 Length:210 Species:Arabidopsis thaliana


Alignment Length:167 Identity:80/167 - (47%)
Similarity:112/167 - (67%) Gaps:3/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||..||:||||||||||:.:|..|...:.. ....|||:||||:.:.:..|::||.|||||||||
plant    10 YDLSFKILLIGDSGVGKSSLLVSFISSSVE-DLAPTIGVDFKIKQLTVGGKRLKLTIWDTAGQER 73

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKN-WIRNIE-ENASADVEKMLLGNKCELTDKRQVS 132
            |||:|::|||||.||:||||:|:.::|.|:.: |.:.|| .:.:.:..:||:|||.:...:|.||
plant    74 FRTLTSSYYRGAQGIILVYDVTRRETFTNLVDVWGKEIELYSTNQECVRMLVGNKVDRESERGVS 138

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI 169
            :|.|..||.|....|:|.||:...|||:.|..||..|
plant   139 REEGIALAKELNCMFLECSARTRQNVEQCFEELALKI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 79/166 (48%)
RABC2ANP_568121.1 PLN03118 1..210 CDD:215587 80/167 (48%)

Return to query results.
Submit another query.