DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and ARA6

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_567008.1 Gene:ARA6 / 824649 AraportID:AT3G54840 Length:202 Species:Arabidopsis thaliana


Alignment Length:154 Identity:69/154 - (44%)
Similarity:104/154 - (67%) Gaps:1/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIEL-DNKKIKLQIWDTAGQERFRTI 73
            ||:|:|||||||:||:.||....|:.|...|:|..|..:||.| |:..:|.:|||||||||:..:
plant    35 KLVLLGDSGVGKSCIVLRFVRGQFDATSKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYSAL 99

  Fly    74 TTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQ 138
            ...|||||...::|||||..:||:..:.|::.::::.|.|:...|:|||.:|.:||:|..|.|.:
plant   100 APLYYRGAGVAVIVYDITSPESFKKAQYWVKELQKHGSPDIVMALVGNKADLHEKREVPTEDGME 164

  Fly   139 LAIEYGIKFMETSAKASINVEEAF 162
            ||.:.|:.|:|||||.:.|:.:.|
plant   165 LAEKNGMFFIETSAKTADNINQLF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 69/154 (45%)
ARA6NP_567008.1 Rab5_related 33..196 CDD:206653 69/154 (45%)

Return to query results.
Submit another query.