DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB8

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001078278.1 Gene:RAB8 / 824529 AraportID:AT3G53610 Length:216 Species:Arabidopsis thaliana


Alignment Length:178 Identity:123/178 - (69%)
Similarity:148/178 - (83%) Gaps:4/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||.||||||||||||:|:|.|||:.:|.|:||:||||||||||||||.|:|||||||||||||
plant    12 YDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTD-KRQVSK 133
            |||||||||||||||:||||:|.|.||.||:|||||||::||..|.|:|:|||.::.: ||.|.|
plant    77 FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDSVNKILVGNKADMDESKRAVPK 141

  Fly   134 ERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIK---AKTEKRME 178
            .:|:.||.|||:||.|||||.::||||.|.::|.|||   |.|:.|.|
plant   142 SKGQALADEYGMKFFETSAKTNLNVEEVFFSIAKDIKQRLADTDARAE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 118/169 (70%)
RAB8NP_001078278.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 118/166 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 239 1.000 Domainoid score I589
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100934
Inparanoid 1 1.050 250 1.000 Inparanoid score I1031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101252
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X312
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.