DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB8

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_190929.1 Gene:RAB8 / 824529 AraportID:AT3G53610 Length:216 Species:Arabidopsis thaliana


Alignment Length:178 Identity:123/178 - (69%)
Similarity:148/178 - (83%) Gaps:4/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||.||||||||||||:|:|.|||:.:|.|:||:||||||||||||||.|:|||||||||||||
plant    12 YDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTD-KRQVSK 133
            |||||||||||||||:||||:|.|.||.||:|||||||::||..|.|:|:|||.::.: ||.|.|
plant    77 FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDSVNKILVGNKADMDESKRAVPK 141

  Fly   134 ERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIK---AKTEKRME 178
            .:|:.||.|||:||.|||||.::||||.|.::|.|||   |.|:.|.|
plant   142 SKGQALADEYGMKFFETSAKTNLNVEEVFFSIAKDIKQRLADTDARAE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 118/169 (70%)
RAB8NP_190929.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 118/166 (71%)

Return to query results.
Submit another query.