DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABA2c

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_190267.1 Gene:RABA2c / 823836 AraportID:AT3G46830 Length:217 Species:Arabidopsis thaliana


Alignment Length:190 Identity:91/190 - (47%)
Similarity:131/190 - (68%) Gaps:9/190 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||||::|||||||||:.||.||:.:.|.....||||::|..||.:::.|.||.||||||||||
plant     9 YDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTTQVEGKTIKAQIWDTAGQER 73

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKE 134
            :|.||:||||||:|.:||||||:.::|:|:..|:|.:.::|.:::..|:.|||.:|...|.|::|
plant    74 YRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKSDLNHLRSVAEE 138

  Fly   135 RGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI------KAKTEKRMEANN---PPKG 185
            .|:.||.:.|:.|:||||..:.|||:||.|:..:|      ||...:...|.|   |.:|
plant   139 DGQSLAEKEGLSFLETSALEATNVEKAFQTILGEIYHIISKKALAAQEAAAANSAIPGQG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 85/171 (50%)
RABA2cNP_190267.1 PLN03110 1..217 CDD:178657 91/190 (48%)

Return to query results.
Submit another query.