DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABE1c

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_190192.1 Gene:RABE1c / 823749 AraportID:AT3G46060 Length:216 Species:Arabidopsis thaliana


Alignment Length:178 Identity:121/178 - (67%)
Similarity:147/178 - (82%) Gaps:4/178 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||.||||||||||||:|:|.|||:.:|.|:||:||||||||||||||.|:|||||||||||||
plant    12 YDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTD-KRQVSK 133
            |||||||||||||||:||||:|.|.||.||:|||||||::||.:|.|:|:|||.::.: ||.|..
plant    77 FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPT 141

  Fly   134 ERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAK---TEKRME 178
            .:|:.||.||||||.|||||.::||||.|.::..|||.:   |:.|.|
plant   142 AKGQALADEYGIKFFETSAKTNLNVEEVFFSIGRDIKQRLSDTDSRAE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 117/166 (70%)
RABE1cNP_190192.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 117/166 (70%)

Return to query results.
Submit another query.