DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABE1e

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_187601.1 Gene:RABE1e / 820148 AraportID:AT3G09900 Length:218 Species:Arabidopsis thaliana


Alignment Length:183 Identity:122/183 - (66%)
Similarity:150/183 - (81%) Gaps:4/183 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQER 69
            ||||.||||||||||||:|:|.|||:|.|.|:||:||||||||||:|||.|:|||||||||||||
plant    12 YDYLIKLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRIKLQIWDTAGQER 76

  Fly    70 FRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTD-KRQVSK 133
            |||||||||||||||:||||:|.|.||.||:||::|||::||..|.|:|:|||.::.: ||.|..
plant    77 FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDSVNKILVGNKADMDESKRAVPT 141

  Fly   134 ERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAK-TEKRMEANNPPKG 185
            .:|:.||.||||||.|||||.:.|||:.||::|.|||.: ||...:|.  |:|
plant   142 SKGQALADEYGIKFFETSAKTNQNVEQVFLSIAKDIKQRLTESDTKAE--PQG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 116/166 (70%)
RABE1eNP_187601.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 116/166 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 239 1.000 Domainoid score I589
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 250 1.000 Inparanoid score I1031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X312
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.