DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RAB1B

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_016873867.1 Gene:RAB1B / 81876 HGNCID:18370 Length:237 Species:Homo sapiens


Alignment Length:213 Identity:106/213 - (49%)
Similarity:140/213 - (65%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |...|||||||||||||||||:|:|.||::|.:..::|||||:||||||||||.|.|||||||||
Human     1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 65

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            |||||||||::|||||.||::|||:|.::|:.|:|.|::.|:..||.:|.|:|:|||.:||.|:.
Human    66 GQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKV 130

  Fly   131 VSKERG------------------------------------EQLAIEYGIKFMETSAKASINVE 159
            |.....                                    ::.|...||.|:|||||.:.|||
Human   131 VDNTTAKVADGPVCPGSGRWGLLPLTCSPLLFSPLLFSPLPCQEFADSLGIPFLETSAKNATNVE 195

  Fly   160 EAFLTLASDIKAKTEKRM 177
            :||:|:|::||    |||
Human   196 QAFMTMAAEIK----KRM 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 101/201 (50%)
RAB1BXP_016873867.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.