Sequence 1: | NP_001246837.1 | Gene: | Rab8 / 40168 | FlyBaseID: | FBgn0262518 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016873867.1 | Gene: | RAB1B / 81876 | HGNCID: | 18370 | Length: | 237 | Species: | Homo sapiens |
Alignment Length: | 213 | Identity: | 106/213 - (49%) |
---|---|---|---|
Similarity: | 140/213 - (65%) | Gaps: | 40/213 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
Fly 66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
Fly 131 VSKERG------------------------------------EQLAIEYGIKFMETSAKASINVE 159
Fly 160 EAFLTLASDIKAKTEKRM 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab8 | NP_001246837.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 101/201 (50%) |
RAB1B | XP_016873867.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |