DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab3b

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_006238593.1 Gene:Rab3b / 81755 RGDID:620922 Length:228 Species:Rattus norvegicus


Alignment Length:187 Identity:87/187 - (46%)
Similarity:128/187 - (68%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            :.:||:||||:||:|.||||..|||:::|.|...|:||:|||||::|:....|::||||||||||
  Rat    17 QNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQ 81

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            ||:|||||||||||||.:|:||||.|:||..:::|...|:..:..:.:.:|:||||::.::|.:.
  Rat    82 ERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVIP 146

  Fly   133 KERGEQLAIEYGI---------KFMETSAKASINVEEAFLTLASDIKAKTEKRMEAN 180
            .|:|..||.:.|:         .|.|.|||.:|:|.:||..|...|..|....|:.:
  Rat   147 TEKGRLLAEQLGMHTAHTYTWFDFFEASAKENISVRQAFERLVDAICDKMSDSMDTD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 85/174 (49%)
Rab3bXP_006238593.1 P-loop_NTPase 22..195 CDD:304359 83/172 (48%)
RAB 23..192 CDD:197555 82/168 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.