DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and Rab1a

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_112352.2 Gene:Rab1a / 81754 RGDID:619736 Length:205 Species:Rattus norvegicus


Alignment Length:177 Identity:107/177 - (60%)
Similarity:141/177 - (79%) Gaps:4/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |...|||||||||||||||||:|:|.||::|.:..::|||||:||||||||||.|.|||||||||
  Rat     4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTA 68

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            |||||||||::|||||.||::|||:|.::||.|:|.|::.|:..||.:|.|:|:||||:||.|:.
  Rat    69 GQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKV 133

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRM 177
            |.....::.|...||.|:|||||.:.|||::|:|:|::||    |||
  Rat   134 VDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIK----KRM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 102/165 (62%)
Rab1aNP_112352.2 Rab1_Ypt1 10..175 CDD:206661 101/168 (60%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 34..48 6/13 (46%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 66..83 14/16 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..205
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.