DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and RABH1d

DIOPT Version :10

Sequence 1:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_179816.1 Gene:RABH1d / 816761 AraportID:AT2G22290 Length:207 Species:Arabidopsis thaliana


Alignment Length:205 Identity:81/205 - (39%)
Similarity:122/205 - (59%) Gaps:16/205 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTI 73
            :||:.:||..||||.|:.||..|.|:||:.:||||||..:|:.|:::.::||:||||||||||::
plant    10 YKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSL 74

  Fly    74 TTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQ 138
            ..:|.|.:...::|||:....||.|...||..:....:.||..:|:|||.:|.:|||||.|.|:.
plant    75 IPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERAGDVIIVLVGNKTDLVEKRQVSIEEGDS 139

  Fly   139 LAIEYGIKFMETSAKASINVEEAFLTLASDI-------KAKTEKRMEANNPPKGGHQLKPMDSRT 196
            ...|||:.|:||||||..|::..|..:|:.:       ..|.|..::.|        |||..:.:
plant   140 KGREYGVMFIETSAKAGFNIKPLFRKIAAALPGMESYSNTKNEDMVDVN--------LKPTSNSS 196

  Fly   197 K-DSWLSRCS 205
            : |.....||
plant   197 QGDQQGGACS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 72/169 (43%)
RABH1dNP_179816.1 Rab6 10..170 CDD:206654 72/159 (45%)

Return to query results.
Submit another query.