DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and MGC147600

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001072877.1 Gene:MGC147600 / 780339 XenbaseID:XB-GENE-1002559 Length:722 Species:Xenopus tropicalis


Alignment Length:175 Identity:73/175 - (41%)
Similarity:112/175 - (64%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTI 73
            :|::|.||:.|||:..|.|..::.|.....:|:|:||:::|:.:|.:...||:||||||||||:|
 Frog   523 YKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSI 587

  Fly    74 TTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ-------- 130
            ..:|:|.|.|::|:||:|.||||.|::.||..||:..|..:..|::|||.:|   ||        
 Frog   588 AKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDATSEAIPIMMVGNKADL---RQLMAEQGHI 649

  Fly   131 -VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTE 174
             ||...||:|:..||..|.|||||...|:.||.|.||.:::.:.:
 Frog   650 CVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAREVRKRCD 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 73/171 (43%)
MGC147600NP_001072877.1 EF-hand_7 8..65 CDD:372618
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..109
SMC_prok_B <124..>332 CDD:274008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..384
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Rab 523..687 CDD:206640 72/166 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.