DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab13

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001025679.1 Gene:rab13 / 595071 XenbaseID:XB-GENE-6070728 Length:201 Species:Xenopus tropicalis


Alignment Length:207 Identity:138/207 - (66%)
Similarity:171/207 - (82%) Gaps:6/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |||.||:||||||||||||||||::.|||||:||:|:||||||||||||.|::.||||||:||||
 Frog     1 MAKAYDHLFKLLLIGDSGVGKTCLIVRFSEDSFNSTYISTIGIDFKIRTTEIEGKKIKLQVWDTA 65

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            |||||:|||||||||||||:||||||.|:|:|||:||:::|:|||:|.||:|||||||::.:||:
 Frog    66 GQERFKTITTAYYRGAMGIILVYDITDERSYENIQNWMKSIKENAAAGVERMLLGNKCDMENKRK 130

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSR 195
            |.|||||:||.|:||:|.|||||:|.||:|||.|||.||..|..||    :.|.....|....|.
 Frog   131 VPKERGEKLAKEHGIRFFETSAKSSQNVDEAFNTLARDILMKISKR----SAPGVKDPLDLKSSS 191

  Fly   196 TKDSWLSRCSLL 207
            .|.|  ::||:|
 Frog   192 KKGS--NKCSVL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 123/165 (75%)
rab13NP_001025679.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 123/165 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.