| Sequence 1: | NP_001246837.1 | Gene: | Rab8 / 40168 | FlyBaseID: | FBgn0262518 | Length: | 207 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001082896.1 | Gene: | zgc:162879 / 572256 | ZFINID: | ZDB-GENE-070424-92 | Length: | 663 | Species: | Danio rerio |
| Alignment Length: | 204 | Identity: | 82/204 - (40%) |
|---|---|---|---|
| Similarity: | 121/204 - (59%) | Gaps: | 17/204 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 LFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRT 72
Fly 73 ITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ----VSK 133
Fly 134 ERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIK--AKTEKRMEANNPPKGGHQLK-PMDSR 195
Fly 196 TKDSWLSRC 204 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Rab8 | NP_001246837.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 72/169 (43%) |
| zgc:162879 | NP_001082896.1 | EFh | 5..60 | CDD:238008 | |
| EF-hand_7 | 6..60 | CDD:290234 | |||
| TMPIT | 104..>187 | CDD:285135 | |||
| RILP-like | <180..290 | CDD:304877 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 324..343 | ||||
| RAB | 468..634 | CDD:197555 | 71/165 (43%) | ||
| Rab | 468..630 | CDD:206640 | 70/161 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0078 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||