DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab8a

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001083031.1 Gene:rab8a / 571897 ZFINID:ZDB-GENE-070424-36 Length:207 Species:Danio rerio


Alignment Length:207 Identity:167/207 - (80%)
Similarity:184/207 - (88%) Gaps:0/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTA 65
            |||||||||||||||||||||||:||||||||||:||||||||||||||||||.|||||||||||
Zfish     1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTA 65

  Fly    66 GQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQ 130
            ||||||||||||||||||||||||||.||||:|||||||||||:||||||||:|||||::.:|||
Zfish    66 GQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINEKRQ 130

  Fly   131 VSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSR 195
            |||:|||:||:|||||||||||||:||||.||||||.|||||.:.::|.|||....|.:|....:
Zfish   131 VSKDRGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTKLEGNNPQGSNHGVKITTEQ 195

  Fly   196 TKDSWLSRCSLL 207
            .|.|...||.||
Zfish   196 PKKSSFFRCVLL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 148/165 (90%)
rab8aNP_001083031.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 148/165 (90%)
RAB 9..172 CDD:197555 145/162 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 294 1.000 Domainoid score I1473
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100934
Inparanoid 1 1.050 337 1.000 Inparanoid score I2358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 1 1.000 - - FOG0000502
OrthoInspector 1 1.000 - - otm25483
orthoMCL 1 0.900 - - OOG6_101252
Panther 1 1.100 - - LDO PTHR47980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1998
SonicParanoid 1 1.000 - - X312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.000

Return to query results.
Submit another query.