DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab3da

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001139069.1 Gene:rab3da / 567288 ZFINID:ZDB-GENE-080722-14 Length:223 Species:Danio rerio


Alignment Length:197 Identity:92/197 - (46%)
Similarity:136/197 - (69%) Gaps:14/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            :.:||:||||:||:|.||||..|||:::|:|.:.|:||:|||||::|:..:.|::||||||||||
Zfish    20 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNEKRVKLQIWDTAGQ 84

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            ||:|||||||||||||.:|:||||.:.||..:::|...|:..:..:.:.:|:||||:|.|.|.|:
Zfish    85 ERYRTITTAYYRGAMGFLLMYDITNQDSFYAVQDWATQIKTYSWDNAQVILVGNKCDLEDDRLVA 149

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEA--------------NNPP 183
            :|.|::||.|.|.:|.|.|||.:|||::.|..|...|..|..:.::.              :.||
Zfish   150 REDGQRLANELGFQFFEASAKDNINVKQVFERLVDIICDKMNESLDTDPSILTNQKGPSLQDTPP 214

  Fly   184 KG 185
            .|
Zfish   215 DG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 88/165 (53%)
rab3daNP_001139069.1 Rab3 25..189 CDD:206657 86/163 (53%)
RAB 26..186 CDD:197555 85/159 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.