Sequence 1: | NP_001246837.1 | Gene: | Rab8 / 40168 | FlyBaseID: | FBgn0262518 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139069.1 | Gene: | rab3da / 567288 | ZFINID: | ZDB-GENE-080722-14 | Length: | 223 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 92/197 - (46%) |
---|---|---|---|
Similarity: | 136/197 - (69%) | Gaps: | 14/197 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
Fly 68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
Fly 133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEA--------------NNPP 183
Fly 184 KG 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab8 | NP_001246837.1 | Rab8_Rab10_Rab13_like | 6..172 | CDD:206659 | 88/165 (53%) |
rab3da | NP_001139069.1 | Rab3 | 25..189 | CDD:206657 | 86/163 (53%) |
RAB | 26..186 | CDD:197555 | 85/159 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |