DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and cracr2ab

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_009298523.1 Gene:cracr2ab / 564347 ZFINID:ZDB-GENE-041210-94 Length:773 Species:Danio rerio


Alignment Length:183 Identity:74/183 - (40%)
Similarity:117/183 - (63%) Gaps:1/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRT 72
            |||::|:|:|.||||.:|.||.:..|::...:|:|||:.:||:.|.:..:.||:||||||||:|:
Zfish   586 LFKVILVGNSSVGKTALLRRFCDGQFHSATSATVGIDYSVRTLNLGDSHVALQLWDTAGQERYRS 650

  Fly    73 ITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGE 137
            ||..::|.|.|::::||||.|.||.:::.|:.:|:|.....:..||||||.:..::|:|..:..:
Zfish   651 ITKQFFRKADGVVVIYDITMEDSFSSVRPWLSSIQEAVGDPIPVMLLGNKSDKENEREVQTKEAD 715

  Fly   138 QLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLK 190
            .||.|..:.|.|.||....||.||.:.||..:: :.|.|:..|....|...||
Zfish   716 LLAEEANLMFYECSAYTGANVLEAMIHLARVLR-EQEDRVWVNTVRLGDQPLK 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 68/163 (42%)
cracr2abXP_009298523.1 EFh 46..106 CDD:238008
EF-hand_7 47..98 CDD:290234
FAM184 210..390 CDD:292293
RAB 587..745 CDD:197555 66/157 (42%)
Rab 587..745 CDD:206640 66/157 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.