DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab8 and rab3b

DIOPT Version :9

Sequence 1:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_685654.3 Gene:rab3b / 557482 ZFINID:ZDB-GENE-050208-660 Length:217 Species:Danio rerio


Alignment Length:180 Identity:87/180 - (48%)
Similarity:136/180 - (75%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67
            :.:||:||||:||:|.||||..|||:::|:|:::|:||:|||||::|:..::|::||||||||||
Zfish    16 QNFDYMFKLLIIGNSSVGKTSFLFRYADDSFSSSFVSTVGIDFKVKTVYRNDKRVKLQIWDTAGQ 80

  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132
            ||:|||||||||||||.:|:||||.|:|:..:::|...|:..:..:.:.:|:||||::.::|.|.
Zfish    81 ERYRTITTAYYRGAMGFILMYDITNEESYNAVQDWATQIKTYSWDNAQVILVGNKCDMDEERVVP 145

  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNP 182
            .|:|:.||.:.|.::.|.|||.:|||.:.|..|...|..|..:|::...|
Zfish   146 FEKGKHLADQLGFEYYEASAKENINVRQVFERLVDIICVKMSERVDVEPP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 84/165 (51%)
rab3bXP_685654.3 P-loop_NTPase 21..185 CDD:304359 82/163 (50%)
RAB 22..182 CDD:197555 81/159 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426655at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.